Job description

Your Job As a Frontend Architect, you will drive the design and architecture of scalable, high-performance frontend applications, leveraging modern JavaScript frameworks and Microsoft Power Platform to improve user experience and support digital transformation. Our Team You will be part of a dynamic team that collaborates globally to align architecture with business goals. Our team values innovation, collaboration, and continuous improvement, and we are committed to delivering high-quality, user-centric solutions that meet our business needs. What You Will Do • Frontend Architecture: Design and implement scalable, secure, high-performance frontend applications using modern JavaScript frameworks (React, Angular, or Vue.js). Ensure cross-browser compatibility, responsiveness, UI/UX Architecture, and accessibility (WCAG). • Solution Design & Development: Architect component-based, modular UI solutions with reusable design systems and patterns. Implement robust state management (Redux, Context API, RxJS), frontend architecture patterns, state management, application lifecycle, modularization, and dependency management and integrate with backend APIs and microservices. • Automation & DevOps: Develop and maintain frontend build and deployment pipelines (Webpack, Vite, npm/yarn). Implement CI/CD pipelines with Azure DevOps or GitHub Actions, and automate testing using Jest, Cypress, or Playwright. • Power Platform Development: Build custom business applications using Power Apps, Power Automate, and Power BI. Develop intelligent, user-facing solutions using AI Builder and Azure services. • PCF Controls Development: Design and develop custom PowerApps Component Framework (PCF) controls to enhance the functionality and user experience of PowerApps applications. • Security & Compliance: Ensure frontend solutions adhere to security best practices (XSS/CSRF prevention, secure authentication flows) and regulatory compliance (GDPR, HIPAA, etc.), utilizing services like Azure Entra ID for identity management. • Architecture Governance: Establish and enforce frontend architecture principles, coding standards, design-system governance, technology guardrails, and review processes. Lead architecture reviews, document key decisions, manage technical debt and exceptions, and ensure solutions remain aligned with enterprise architecture, security, compliance, accessibility, and lifecycle standards. Architects should use Architecture Decision Records to document the rationale behind key architectural decisions. • Performance & Optimization: Continuously monitor and optimize application performance (Core Web Vitals, bundle size, lazy loading, rendering efficiency) using tools like Lighthouse, Azure Monitor, and Application Insights. • Collaboration & Documentation: Work with global teams to align architecture with business goals and maintain technical documentation, UI style guides, and flowcharts. • Mentorship: Train and mentor junior frontend developers on modern development practices and design system standards. • Stakeholder Engagement: Collaborate with business stakeholders and designers to understand requirements and translate them into intuitive, technical UI solutions. Who You Are (Basic Qualifications) • Bachelor’s degree in Computer Science, Information Systems, or a related field. • 5+ years of experience in frontend architecture and application development using modern JavaScript frameworks (React, Angular, or Vue.js), along with Microsoft Power Platform (Power Apps, Power Automate, Power BI). • 4+ years of hands-on experience building enterprise-grade UI components, including PowerApps Component Framework (PCF) controls and Azure-integrated frontend solutions. • 5+ years of professional software development experience with JavaScript/TypeScript, HTML5, and CSS3/SASS, focusing on frontend architecture, component design, and UI/UX best practices. • Proven experience designing and consuming REST/GraphQL APIs for integration between frontend applications and backend or legacy systems. • Experience with frontend build tools and automation (Webpack, Vite, npm/yarn) and CI/CD pipelines using Azure DevOps or GitHub Actions. • Experience with responsive design, cross-browser compatibility, and accessibility standards (WCAG 2.1). • Demonstrated understanding of the Software Development Life Cycle (SDLC), frontend security best practices, system integration, and regulatory compliance standards (e.g., GDPR, HIPAA). • Experience with API Management, Azure CDN, Azure Storage, or similar Azure services. • Strong understanding of Domain-Driven Design, microservices, event-driven architecture, and enterprise integration patterns. • Experience defining and applying architecture governance, including technical standards, design and code review gates, decision records, exception management, risk controls, technical-debt oversight, and alignment with enterprise architecture. • Strong skills in state management, component reusability, design systems, and performance optimization practices. • Drive CI CD adoption automation and cloud native frontend development initiatives • Evaluate emerging technologies build POCs and resolve complex production issues • Conduct system assessments and performance reviews to identify areas for improvement and optimization. • Ensure compliance with security, privacy, and regulatory requirements in the design and implementation of solutions. • Collaborate with project managers to define project scope, timelines, and deliverables, and provide technical input for project planning and estimation. What Will Put You Ahead • Master’s degree in Computer Science, Information Systems, or related discipline. • Experience with micro-frontend architectures and Module Federation. • Proficiency with design tools like Figma or Adobe XD, and experience translating designs into production-ready code. • Experience with Azure cloud services (App Services, Functions, Azure CDN) for frontend hosting and content delivery. • Experience working in cross-functional teams in a global environment and mentoring software developers. For this role, we anticipate paying $110,000 - $160,000 per year. This role is eligible for variable pay, issued as a monetary bonus or in another form. At Koch companies, we are entrepreneurs. This means we openly challenge the status quo, find new ways to create value and get rewarded for our individual contributions. Any compensation range provided for a role is an estimate determined by available market data. The actual amount may be higher or lower than the range provided considering each candidate's knowledge, skills, abilities, and geographic location. If you have questions, please speak to your recruiter about the flexibility and detail of our compensation philosophy. Hiring Philosophy All Koch companies value diversity of thought, perspectives, aptitudes, experiences, and backgrounds. We are Military Ready and Second Chance employers. Learn more about our hiring philosophy here . Who We Are As a Koch company, Molex is a leading supplier of connectors and interconnect components, driving innovation in electronics and supporting industries from automotive to health care and consumer to data communications. The thousands of innovators who work for Molex have made us a global electronics leader. Our experienced people, groundbreaking products and leading-edge technologies help us deliver a wider array of solutions to more markets than ever before. At Koch, employees are empowered to do what they do best to make life better. Learn how our business philosophy helps employees unleash their potential while creating value for themselves and the company. Our Benefits Our goal is for each employee, and their families, to live fulfilling and healthy lives. We provide essential resources and support to build and maintain physical, financial, and emotional strength - focusing on overall wellbeing so you can focus on what matters most. Our benefits plan includes - medical, dental, vision, flexible spending and health savings accounts, life insurance, ADD, disability, retirement, paid vacation/time off, educational assistance, and may also include infertility assistance, paid parental leave and adoption assistance. Specific eligibility criteria is set by the applicable Summary Plan Description, policy or guideline and benefits may vary by geographic region. If you have questions on what benefits apply to you, please speak to your recruiter. Additionally, everyone has individual work and personal needs. We seek to enable the best work environment that helps you and the business work together to produce superior results. Equal Opportunities Equal Opportunity Employer, including disability and protected veteran status. Except where prohibited by state law, some offers of employment are conditioned upon successfully passing a drug test. This employer uses E-Verify. Please click here for additional information. (For Illinois E-Verify information click here , aquí , or tu ).

Requirements

Must-haves

Power Platform Development: Build custom business applications using Power Apps, Power Automate, and Power BI. Develop intelligent, user-facing solutions using AI Builder and Azure services.
PCF Controls Development: Design and develop custom PowerApps Component Framework (PCF) controls to enhance the functionality and user experience of PowerApps applications.
Collaboration & Documentation: Work with global teams to align architecture with business goals and maintain technical documentation, UI style guides, and flowcharts.
Mentorship: Train and mentor junior frontend developers on modern development practices and design system standards.
Stakeholder Engagement: Collaborate with business stakeholders and designers to understand requirements and translate them into intuitive, technical UI solutions.
Who You Are (Basic Qualifications)
Bachelor’s degree in Computer Science, Information Systems, or a related field.
5+ years of experience in frontend architecture and application development using modern JavaScript frameworks (React, Angular, or Vue.js), along with Microsoft Power Platform (Power Apps, Power Automate, Power BI).
4+ years of hands-on experience building enterprise-grade UI components, including PowerApps Component Framework (PCF) controls and Azure-integrated frontend solutions.
5+ years of professional software development experience with JavaScript/TypeScript, HTML5, and CSS3/SASS, focusing on frontend architecture, component design, and UI/UX best practices.
Proven experience designing and consuming REST/GraphQL APIs for integration between frontend applications and backend or legacy systems.
Experience with frontend build tools and automation (Webpack, Vite, npm/yarn) and CI/CD pipelines using Azure DevOps or GitHub Actions.
Experience with responsive design, cross-browser compatibility, and accessibility standards (WCAG 2.1).
Demonstrated understanding of the Software Development Life Cycle (SDLC), frontend security best practices, system integration, and regulatory compliance standards (e.g., GDPR, HIPAA).
Experience with API Management, Azure CDN, Azure Storage, or similar Azure services.
Strong understanding of Domain-Driven Design, microservices, event-driven architecture, and enterprise integration patterns.
Strong skills in state management, component reusability, design systems, and performance optimization practices.
Drive CI CD adoption automation and cloud native frontend development initiatives
Evaluate emerging technologies build POCs and resolve complex production issues
Conduct system assessments and performance reviews to identify areas for improvement and optimization.
Ensure compliance with security, privacy, and regulatory requirements in the design and implementation of solutions.
Collaborate with project managers to define project scope, timelines, and deliverables, and provide technical input for project planning and estimation.
What Will Put You Ahead

Nice-to-haves

For this role, we anticipate paying $110,000 - $160,000 per year. This role is eligible for variable pay, issued as a monetary bonus or in another form.

Application prep

Use the role’s language and application details while tailoring your materials.

Keywords to mirror

javascriptreactangularvueaccessibilitydesign systemsapici/cdazureaidesign systemtypescriptrestgraphqlfigma

Platform: avature
Effort: medium

Benefits

Benefits detected in the listing.

Dental

Vision

Parental Leave