Job description

At ICF Next, we are fearless in finding new ways to solve problems, relentless in making sure it pays off for our clients and committed to making a positive change in the world. Join our community of mission-driven creatives, communicators, strategists, and technologists to challenge the status quo. The Team You ll lead a delivery team within a cross-functional program that includes software engineers, solution and cloud architects, database administrators, DevSecOps engineers, quality assurance specialists, user experience professionals, business analysts, product managers, data analysts, accessibility and security specialists, and behavioral health subject matter experts. We partner with federal stakeholders to operate and modernize a mission-critical data collection and performance reporting platform used by grantees and program staff. The Work In this player-coach role, you will provide day-to-day technical leadership while remaining hands-on in the design, development, testing, and support of secure .NET applications. You will guide engineers through solution design and implementation, organize technical work, review code, resolve blockers, and help the team deliver dependable capabilities for data entry, batch ingestion, validation, workflow, reporting, and data exchange. A key part of the work is improving the platform without disrupting active users. You will help the team modernize legacy components incrementally, strengthen engineering practices, improve performance and data quality, expand automated testing and deployment, and make production behavior easier to observe and troubleshoot. You will also coach engineers and communicate technical options, risks, and progress to program and client stakeholders. Key Responsibilities: Lead a team of software engineers by organizing technical work, clarifying priorities, removing blockers, reviewing outcomes, and providing practical coaching and feedback. Design, develop, and maintain production web applications using C#, .NET, ASP.NET Core or MVC, and modern JavaScript or TypeScript. Translate product, data, security, accessibility, and operational requirements into clear technical designs and implementation plans. Guide the design of REST APIs, domain models, SQL Server data structures, queries, and integrations with internal and external systems. Oversee capabilities for data entry, batch upload, validation, duplicate detection, workflow, notifications, reporting, and data download. Establish expectations for automated tests, code quality, peer review, branching, release readiness, and maintainable documentation. Support continuous integration and deployment practices and coordinate application releases with cloud, DevSecOps, database, security, and quality assurance teams. Lead investigation of production defects and performance issues using application logs, monitoring data, root-cause analysis, and tested corrective actions. Ensure the team applies secure coding, least-privilege access, role-based authorization, privacy, Section 508, and WCAG requirements throughout delivery. Participate in Agile planning, estimation, demonstrations, release activities, and user acceptance testing while communicating dependencies, risks, and tradeoffs to stakeholders. Contribute to shared engineering standards and mentor less-experienced engineers across the program. Required Qualifications: Bachelor’s degree in computer science, software engineering, information systems, or a related field, or equivalent professional experience. 5 years developing and supporting resilient, well-tested production web applications, including 3 years using C#, .NET or .NET Core, and ASP.NET MVC or Web API with object-oriented design. 2 years leading or providing technical direction to software engineers, including reviewing code, resolving technical blockers, documenting decisions, and communicating with stakeholders. 3 years working with SQL Server or another relational database, including data modeling, query development, and performance troubleshooting. 2 years developing REST APIs and browser-based applications using JSON, HTML, CSS, and JavaScript or TypeScript, with a strong understanding of HTTP and HTTPS/TLS. 2 years using automated testing and Git-based development workflows, including pull requests, code reviews, and release management; 1 year supporting cloud-hosted applications using containers or comparable deployment approaches. 2 years implementing authentication, authorization, role-based access, and secure handling of sensitive data. Authorization to work in the United States, ability to perform all work within the United States, and ability to obtain and maintain a favorable Public Trust determination and complete required background screening. Preferred Qualifications: Experience leading incremental modernization of legacy .NET applications while maintaining reliable production service. Experience troubleshooting production performance and reliability issues in AWS or AWS GovCloud using monitoring and logging tools such as CloudWatch or Splunk. Experience improving CI/CD pipelines, automated quality checks, container deployment, and repeatable environment configuration using infrastructure as code. Experience integrating Okta or another federated identity platform for single sign-on and multifactor authentication. Experience designing or supporting batch data ingestion, ETL, data validation, or business intelligence integrations such as Tableau. Experience supporting federal or public health systems, with familiarity with NIST Moderate controls, FedRAMP, ATO processes, or Section 508/WCAG accessibility requirements. *** Please note this role is contingent. #Indeed Bot and Third-Party Applications Please note that this application must be submitted directly by the applicant for consideration. Failure to do so may result in the application being excluded for consideration . Applicants needing an accommodation for disability or religious purposes in connection with the application process should contact Candidateaccommodation icf.com for assistance. Working at ICF ICF is a global advisory and technology services provider, but we’re not your typical consultants. We combine unmatched expertise with cutting-edge technology to help clients solve their most complex challenges, navigate change, and shape the future. We can only solve the world s toughest challenges by building a workplace that allows everyone to thrive. We are an equal opportunity employer . Together, our employees are empowered to share their expertise and collaborate with others to achieve personal and professional goals. For more information, please read our  EEO policy. We will consider for employment qualified applicants with arrest and conviction records. Reasonable Accommodations are available, including, but not limited to, for disabled veterans, individuals with disabilities, and individuals with sincerely held religious beliefs, in all phases of the application and employment process. To request an accommodation, please email  Candidateaccommodation icf.com  and we will be happy to assist . All information you provide will be kept confidential and will be used only to the extent required to provide needed reasonable accommodations.  Read more about  workplace discrimination righ t s or our benefit offerings which are included in the  Transparency in (Benefits) Coverage Act. Candidate AI Usage Policy At ICF, we are committed to ensuring a fair interview process for all candidates based on their own skills and knowledge. As part of this commitment, the use of artificial intelligence (AI) tools to generate or assist with responses during interviews (whether in-person or virtual) is not permitted . This policy is in place to maintain the integrity and authenticity of the interview process.  However, we understand that some candidates may require accommodation that involves the use of AI. If such an accommodation is needed, candidates are instructed to contact us in advance at  candidateaccommodation icf.com . We are dedicated to providing the necessary support to ensure that all candidates have an equal opportunity to succeed.   Pay Range - There are multiple factors that are considered in determining final pay for a position, including, but not limited to, relevant work experience, skills, certifications and competencies that align to the specified role, geographic location, education and certifications as well as contract provisions regarding labor categories that are specific to the position. The pay range for this position based on full-time employment is : $119,323.00 - $202,850.00 Nationwide Remote Office (US99)

Requirements

Must-haves

At ICF Next, we are fearless in finding new ways to solve problems, relentless in making sure it pays off for our clients and committed to making a positive change in the world.
Join our community of mission-driven creatives, communicators, strategists, and technologists to challenge the status quo.
Lead a team of software engineers by organizing technical work, clarifying priorities, removing blockers, reviewing outcomes, and providing practical coaching and feedback.
Design, develop, and maintain production web applications using C#, .NET, ASP.NET Core or MVC, and modern JavaScript or TypeScript.
Translate product, data, security, accessibility, and operational requirements into clear technical designs and implementation plans.
Guide the design of REST APIs, domain models, SQL Server data structures, queries, and integrations with internal and external systems.
Oversee capabilities for data entry, batch upload, validation, duplicate detection, workflow, notifications, reporting, and data download.
Establish expectations for automated tests, code quality, peer review, branching, release readiness, and maintainable documentation.
Support continuous integration and deployment practices and coordinate application releases with cloud, DevSecOps, database, security, and quality assurance teams.
Lead investigation of production defects and performance issues using application logs, monitoring data, root-cause analysis, and tested corrective actions.
Ensure the team applies secure coding, least-privilege access, role-based authorization, privacy, Section 508, and WCAG requirements throughout delivery.
Participate in Agile planning, estimation, demonstrations, release activities, and user acceptance testing while communicating dependencies, risks, and tradeoffs to stakeholders.

Nice-to-haves

Experience leading incremental modernization of legacy .NET applications while maintaining reliable production service.
Experience troubleshooting production performance and reliability issues in AWS or AWS GovCloud using monitoring and logging tools such as CloudWatch or Splunk.
Experience improving CI/CD pipelines, automated quality checks, container deployment, and repeatable environment configuration using infrastructure as code.
Experience integrating Okta or another federated identity platform for single sign-on and multifactor authentication.
Experience designing or supporting batch data ingestion, ETL, data validation, or business intelligence integrations such as Tableau.
Experience supporting federal or public health systems, with familiarity with NIST Moderate controls, FedRAMP, ATO processes, or Section 508/WCAG accessibility requirements.
Please note this role is contingent.
Bot and Third-Party Applications
Working at ICF
We will consider for employment qualified applicants with arrest and conviction records.
Read more about  workplace discrimination righ t s or our benefit offerings which are included in the  Transparency in (Benefits) Coverage Act.
Candidate AI Usage Policy

Application prep

Use the role’s language and application details while tailoring your materials.

Keywords to mirror

accessibilityjavascripttypescriptrestsqlagileapiawsci/cdai

Platform: workday
Effort: long

Benefits

Benefits detected in the listing.

Vision